Tags

Type your tag names separated by a space and hit enter

An insecticidal toxin from Nephila clavata spider venom.
Amino Acids. 2017 07; 49(7):1237-1245.AA

Abstract

Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on NaV and KV channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

Authors+Show Affiliations

College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China.College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China.College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China.College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China.Key Laboratory of Animal Models and Human Disease Mechanisms, Chinese Academy of Sciences and Yunnan Province, Kunming Institute of Zoology, Kunming, 650223, Yunnan, China. Sino-African Joint Research Center, CAS, Kunming Institute of Zoology, Kunming, 650223, Yunnan, China. University of Chinese Academy of Sciences, Beijing, 100009, China.Key Laboratory of Animal Models and Human Disease Mechanisms, Chinese Academy of Sciences and Yunnan Province, Kunming Institute of Zoology, Kunming, 650223, Yunnan, China.College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China.College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China. Key Laboratory of Animal Models and Human Disease Mechanisms, Chinese Academy of Sciences and Yunnan Province, Kunming Institute of Zoology, Kunming, 650223, Yunnan, China. Sino-African Joint Research Center, CAS, Kunming Institute of Zoology, Kunming, 650223, Yunnan, China.College of Life Sciences, Nanjing Agricultural University, Nanjing, 210095, Jiangsu, China. yanxw@njau.edu.cn.Clinical Laboratory, The Second Affiliated Hospital of Kunming Medical University, Kunming, 650101, Yunnan, China. wangym992011@163.com.Key Laboratory of Animal Models and Human Disease Mechanisms, Chinese Academy of Sciences and Yunnan Province, Kunming Institute of Zoology, Kunming, 650223, Yunnan, China. yangsl@mail.kiz.ac.cn.

Pub Type(s)

Journal Article
Research Support, Non-U.S. Gov't

Language

eng

PubMed ID

28497266

Citation

Jin, Lin, et al. "An Insecticidal Toxin From Nephila Clavata Spider Venom." Amino Acids, vol. 49, no. 7, 2017, pp. 1237-1245.
Jin L, Fang M, Chen M, et al. An insecticidal toxin from Nephila clavata spider venom. Amino Acids. 2017;49(7):1237-1245.
Jin, L., Fang, M., Chen, M., Zhou, C., Ombati, R., Hakim, M. A., Mo, G., Lai, R., Yan, X., Wang, Y., & Yang, S. (2017). An insecticidal toxin from Nephila clavata spider venom. Amino Acids, 49(7), 1237-1245. https://doi.org/10.1007/s00726-017-2425-2
Jin L, et al. An Insecticidal Toxin From Nephila Clavata Spider Venom. Amino Acids. 2017;49(7):1237-1245. PubMed PMID: 28497266.
* Article titles in AMA citation format should be in sentence-case
TY - JOUR T1 - An insecticidal toxin from Nephila clavata spider venom. AU - Jin,Lin, AU - Fang,Mingqian, AU - Chen,Mengrou, AU - Zhou,Chunling, AU - Ombati,Rose, AU - Hakim,Md Abdul, AU - Mo,Guoxiang, AU - Lai,Ren, AU - Yan,Xiuwen, AU - Wang,Yumin, AU - Yang,Shilong, Y1 - 2017/05/11/ PY - 2016/10/06/received PY - 2017/04/17/accepted PY - 2017/5/13/pubmed PY - 2018/2/24/medline PY - 2017/5/13/entrez KW - Bioinsecticide KW - Nephila clavata KW - Spider KW - Toxin KW - Venom SP - 1237 EP - 1245 JF - Amino acids JO - Amino Acids VL - 49 IS - 7 N2 - Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on NaV and KV channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented. SN - 1438-2199 UR - https://www.unboundmedicine.com/medline/citation/28497266/An_insecticidal_toxin_from_Nephila_clavata_spider_venom_ L2 - https://dx.doi.org/10.1007/s00726-017-2425-2 DB - PRIME DP - Unbound Medicine ER -